Lineage for d1bwma2 (1bwm A:3-116A)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 8110Protein T-cell antigen receptor [48933] (5 species)
  7. 8145Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (11 PDB entries)
  8. 8162Domain d1bwma2: 1bwm A:3-116A [20643]

Details for d1bwma2

PDB Entry: 1bwm (more details)

PDB Description: a single-chain t cell receptor
PDB Compounds: (A:)

SCOP Domain Sequences for d1bwma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwma2 b.1.1.1 (A:3-116A) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvl

SCOP Domain Coordinates for d1bwma2:

Click to download the PDB-style file with coordinates for d1bwma2.
(The format of our PDB-style files is described here.)

Timeline for d1bwma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bwma1