Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries) |
Domain d2vrec1: 2vre C:24-282 [206424] Other proteins in same PDB: d2vrea2, d2vreb2, d2vrec2 automated match to d3g64c_ complexed with cl |
PDB Entry: 2vre (more details), 1.95 Å
SCOPe Domain Sequences for d2vrec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vrec1 c.14.1.0 (C:24-282) automated matches {Human (Homo sapiens) [TaxId: 9606]} apdhsyeslrvtsaqkhvlhvqlnrpnkrnamnkvfwremvecfnkisrdadcravvisg agkmftagidlmdmasdilqpkgddvariswylrdiitryqetfnviercpkpviaavhg gcigggvdlvtacdirycaqdaffqvkevdvglaadvgtlqrlpkvignqslvnelafta rkmmadealgsglvsrvfpdkevmldaalalaaeisskspvavqstkvnllysrdhsvae slnyvaswnmsmlqtqdlv
Timeline for d2vrec1:
View in 3D Domains from other chains: (mouse over for more information) d2vrea1, d2vrea2, d2vreb1, d2vreb2 |