Lineage for d1d9kf_ (1d9k F:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 364249Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 364315Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (17 PDB entries)
  8. 364340Domain d1d9kf_: 1d9k F: [20642]
    Other proteins in same PDB: d1d9kc1, d1d9kc2, d1d9kd1, d1d9kd2, d1d9kg1, d1d9kg2, d1d9kh1, d1d9kh2

Details for d1d9kf_

PDB Entry: 1d9k (more details), 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca

SCOP Domain Sequences for d1d9kf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9kf_ b.1.1.1 (F:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvlgs

SCOP Domain Coordinates for d1d9kf_:

Click to download the PDB-style file with coordinates for d1d9kf_.
(The format of our PDB-style files is described here.)

Timeline for d1d9kf_: