Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.0: automated matches [191478] (1 protein) not a true family |
Protein automated matches [190767] (7 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [188473] (5 PDB entries) |
Domain d2vq9a_: 2vq9 A: [206417] automated match to d4aoha_ complexed with cl |
PDB Entry: 2vq9 (more details), 1.85 Å
SCOPe Domain Sequences for d2vq9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vq9a_ d.5.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} irrryehfltqhvyggiteqtcdrvmrqrritrfptgndckevntfiqangnhvrtvctg ggtrqtdnrdlymsndqftvitctlrsgerhpncryrgkessrkivvacegewpahyerg viv
Timeline for d2vq9a_: