Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Soybean (Glycine max) [TaxId:3847] [225580] (5 PDB entries) |
Domain d2vo4b2: 2vo4 B:84-219 [206400] Other proteins in same PDB: d2vo4a1, d2vo4b1 automated match to d1gwca1 complexed with 4nm, gol, gtb |
PDB Entry: 2vo4 (more details), 1.75 Å
SCOPe Domain Sequences for d2vo4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vo4b2 a.45.1.0 (B:84-219) automated matches {Soybean (Glycine max) [TaxId: 3847]} llpsdpyqraqtrfwadyvdkkiydlgrkiwtskgeekeaakkefiealklleeqlgdkt yfggdnlgfvdialvpfytwfkayetfgtlniesecpkfiawakrclqkesvakslpdqq kvyefimdlrkklgie
Timeline for d2vo4b2: