Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
Protein automated matches [226871] (19 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:1061] [225020] (7 PDB entries) |
Domain d2vnkc2: 2vnk C:114-272 [206394] Other proteins in same PDB: d2vnka1, d2vnkb1, d2vnkc1, d2vnkd1 automated match to d1a8pa2 complexed with fad, nap |
PDB Entry: 2vnk (more details), 1.93 Å
SCOPe Domain Sequences for d2vnkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vnkc2 c.25.1.0 (C:114-272) automated matches {Rhodobacter capsulatus [TaxId: 1061]} idallpgkrlwflatgtgiapfaslmrepeayekfdevimmhacrtvaeleygrqlveal qedpligelvegklkyyptttreefhhmgritdnlasgkvfedlgiapmnpetdramvcg slafnvdvmkvlesyglreganseprefvvekafvgegi
Timeline for d2vnkc2: