Lineage for d2vigh2 (2vig H:259-413)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1488075Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1488205Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1488206Protein automated matches [226935] (18 species)
    not a true protein
  7. 1488275Species Human (Homo sapiens) [TaxId:9606] [225243] (4 PDB entries)
  8. 1488283Domain d2vigh2: 2vig H:259-413 [206377]
    Other proteins in same PDB: d2viga1, d2vigb1, d2vigc1, d2vigd1, d2vige1, d2vigf1, d2vigg1, d2vigh1
    automated match to d1jqia1
    complexed with cos, edo, fad

Details for d2vigh2

PDB Entry: 2vig (more details), 1.9 Å

PDB Description: crystal structure of human short-chain acyl coa dehydrogenase
PDB Compounds: (H:) short-chain specific acyl-coa dehydrogenase,

SCOPe Domain Sequences for d2vigh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vigh2 a.29.3.0 (H:259-413) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgfkiamqtldmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladma
lalesarlltwraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempa
erhyrdariteiyegtseiqrlviaghllrsyrsa

SCOPe Domain Coordinates for d2vigh2:

Click to download the PDB-style file with coordinates for d2vigh2.
(The format of our PDB-style files is described here.)

Timeline for d2vigh2: