Lineage for d1nfdd1 (1nfd D:1-117)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354864Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2355009Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)
  8. 2355047Domain d1nfdd1: 1nfd D:1-117 [20636]
    Other proteins in same PDB: d1nfda2, d1nfdb2, d1nfdc2, d1nfdd2, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2
    complexed with nag, ndg

Details for d1nfdd1

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
PDB Compounds: (D:) n15 alpha-beta T-cell receptor

SCOPe Domain Sequences for d1nfdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfdd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl
psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvle

SCOPe Domain Coordinates for d1nfdd1:

Click to download the PDB-style file with coordinates for d1nfdd1.
(The format of our PDB-style files is described here.)

Timeline for d1nfdd1: