| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries) |
| Domain d1nfdd1: 1nfd D:1-117 [20636] Other proteins in same PDB: d1nfda2, d1nfdb2, d1nfdc2, d1nfdd2, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2 complexed with nag, ndg |
PDB Entry: 1nfd (more details), 2.8 Å
SCOPe Domain Sequences for d1nfdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfdd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl
psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvle
Timeline for d1nfdd1: