Lineage for d2veva_ (2vev A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130872Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2130873Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2130985Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2131029Protein Tyrosine phosphatase [52806] (7 species)
  7. 2131030Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (128 PDB entries)
    Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
  8. 2131040Domain d2veva_: 2vev A: [206342]
    automated match to d1xboa_
    complexed with iz2, mg

Details for d2veva_

PDB Entry: 2vev (more details), 1.8 Å

PDB Description: crystal structure of protein tyrosine phosphatase 1b in complex with an isothiazolidinone-containing inhibitor
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d2veva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2veva_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle

SCOPe Domain Coordinates for d2veva_:

Click to download the PDB-style file with coordinates for d2veva_.
(The format of our PDB-style files is described here.)

Timeline for d2veva_: