Lineage for d1jckc1 (1jck C:3-117)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512530Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1512673Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)
  8. 1512709Domain d1jckc1: 1jck C:3-117 [20634]
    Other proteins in same PDB: d1jcka2, d1jckb1, d1jckb2, d1jckc2, d1jckd1, d1jckd2

Details for d1jckc1

PDB Entry: 1jck (more details), 3.5 Å

PDB Description: t-cell receptor beta chain complexed with sec3 superantigen
PDB Compounds: (C:) 14.3.d t cell antigen receptor

SCOPe Domain Sequences for d1jckc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jckc1 b.1.1.1 (C:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle

SCOPe Domain Coordinates for d1jckc1:

Click to download the PDB-style file with coordinates for d1jckc1.
(The format of our PDB-style files is described here.)

Timeline for d1jckc1: