SCOP 1.73: Domain d1kb5b_: 1kb5 B:

Lineage for d1kb5b_ (1kb5 B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (19 PDB entries)

8. Domain d1kb5b_: 1kb5 B: [20632]
   Other proteins in same PDB: d1kb5h1, d1kb5h2, d1kb5l1, d1kb5l2

Details for d1kb5b_

PDB Entry: 1kb5, 2.5 Å

PDB Description: murine t-cell receptor variable domain/fab complex

PDB Compounds: (B:) kb5-c20 T-cell antigen receptor

SCOP Domain Sequences for d1kb5b_:

Sequence; same for both SEQRES and ATOM records:

>d1kb5b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsaapdwgasaetlyfgsgtrltvl

Timeline for d1kb5b_:

• d1kb5b_ first appeared (with stable ids) in SCOP 1.55
  
• d1kb5b_ appears in SCOP 1.71
  
• d1kb5b_ appears in SCOP 1.75
  
• d1kb5b_ appears in the current release, SCOPe 2.08