Lineage for d1kb5b_ (1kb5 B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288452Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 288516Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (16 PDB entries)
  8. 288524Domain d1kb5b_: 1kb5 B: [20632]
    Other proteins in same PDB: d1kb5h1, d1kb5h2, d1kb5l1, d1kb5l2

Details for d1kb5b_

PDB Entry: 1kb5 (more details), 2.5 Å

PDB Description: murine t-cell receptor variable domain/fab complex

SCOP Domain Sequences for d1kb5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb5b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsaapdwgasaetlyfgsgtrltvl

SCOP Domain Coordinates for d1kb5b_:

Click to download the PDB-style file with coordinates for d1kb5b_.
(The format of our PDB-style files is described here.)

Timeline for d1kb5b_: