Lineage for d1kb5b_ (1kb5 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 52846Protein T-cell antigen receptor [48933] (6 species)
  7. 52894Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (11 PDB entries)
  8. 52900Domain d1kb5b_: 1kb5 B: [20632]
    Other proteins in same PDB: d1kb5h1, d1kb5h2, d1kb5l1, d1kb5l2

Details for d1kb5b_

PDB Entry: 1kb5 (more details), 2.5 Å

PDB Description: murine t-cell receptor variable domain/fab complex
PDB Compounds: (B:)

SCOP Domain Sequences for d1kb5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb5b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsaapdwgasaetlyfgsgtrltvl

SCOP Domain Coordinates for d1kb5b_:

Click to download the PDB-style file with coordinates for d1kb5b_.
(The format of our PDB-style files is described here.)

Timeline for d1kb5b_: