Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) |
Domain d2vcva2: 2vcv A:81-222 [206301] Other proteins in same PDB: d2vcva1, d2vcvb1, d2vcvc1, d2vcvd1, d2vcve1, d2vcvf1, d2vcvg1, d2vcvh1, d2vcvi1, d2vcvj1, d2vcvk1, d2vcvl1, d2vcvm1, d2vcvn1, d2vcvo1, d2vcvp1 automated match to d1agsa1 complexed with asd, gsh |
PDB Entry: 2vcv (more details), 1.8 Å
SCOPe Domain Sequences for d2vcva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcva2 a.45.1.1 (A:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]} lygkdikeralidmytegmadlnemilllplcrpeekdakialikektksryfpafekvl qshgqdylvgnklsradislvellyyveeldsslisnfpllkalktrisnlptvkkflqp gsprkppadakaleearkifrf
Timeline for d2vcva2:
View in 3D Domains from other chains: (mouse over for more information) d2vcvb1, d2vcvb2, d2vcvc1, d2vcvc2, d2vcvd1, d2vcvd2, d2vcve1, d2vcve2, d2vcvf1, d2vcvf2, d2vcvg1, d2vcvg2, d2vcvh1, d2vcvh2, d2vcvi1, d2vcvi2, d2vcvj1, d2vcvj2, d2vcvk1, d2vcvk2, d2vcvl1, d2vcvl2, d2vcvm1, d2vcvm2, d2vcvn1, d2vcvn2, d2vcvo1, d2vcvo2, d2vcvp1, d2vcvp2 |