![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (16 PDB entries) |
![]() | Domain d1tcrb1: 1tcr B:1-117 [20630] Other proteins in same PDB: d1tcra2, d1tcrb2 complexed with fuc, man, nag, so4 |
PDB Entry: 1tcr (more details), 2.5 Å
SCOP Domain Sequences for d1tcrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcrb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain} eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle
Timeline for d1tcrb1: