Lineage for d1qsfd1 (1qsf D:1-117)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931485Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 931486Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries)
  8. 931505Domain d1qsfd1: 1qsf D:1-117 [20626]
    Other proteins in same PDB: d1qsfa1, d1qsfa2, d1qsfb_, d1qsfd2, d1qsfe2

Details for d1qsfd1

PDB Entry: 1qsf (more details), 2.8 Å

PDB Description: structure of a6-tcr bound to hla-a2 complexed with altered htlv-1 tax peptide y8a
PDB Compounds: (D:) hman T-cell receptor

SCOPe Domain Sequences for d1qsfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsfd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

SCOPe Domain Coordinates for d1qsfd1:

Click to download the PDB-style file with coordinates for d1qsfd1.
(The format of our PDB-style files is described here.)

Timeline for d1qsfd1: