Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (159 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [187989] (15 PDB entries) |
Domain d2v6mc1: 2v6m C:22-164 [206255] Other proteins in same PDB: d2v6ma2, d2v6mb2, d2v6mc2, d2v6md2 automated match to d1llda1 complexed with mes |
PDB Entry: 2v6m (more details), 2.2 Å
SCOPe Domain Sequences for d2v6mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v6mc1 c.2.1.0 (C:22-164) automated matches {Thermus thermophilus [TaxId: 300852]} mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd vmtqvayrlsglppgrvvgsg
Timeline for d2v6mc1: