SCOPe 2.03: Domain d2v6ma2: 2v6m A:165-331

Lineage for d2v6ma2 (2v6m A:165-331)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (21 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [225328] (6 PDB entries)

8. Domain d2v6ma2: 2v6m A:165-331 [206252]
   Other proteins in same PDB: d2v6ma1, d2v6mb1, d2v6mc1, d2v6md1
   automated match to d1llda2
   complexed with mes

Details for d2v6ma2

PDB Entry: 2v6m, 2.2 Å

PDB Description: crystal structure of lactate dehydrogenase from thermus thermophilus hb8 (apo form)

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2v6ma2:

Sequence; same for both SEQRES and ATOM records:

>d2v6ma2 d.162.1.0 (A:165-331) automated matches {Thermus thermophilus [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf

Timeline for d2v6ma2:

• d2v6ma2 is new in SCOPe 2.03-stable
  
• d2v6ma2 appears in SCOPe 2.04
  
• d2v6ma2 appears in the current release, SCOPe 2.08