Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (26 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [225330] (1 PDB entry) |
Domain d2v6bd2: 2v6b D:165-325 [206246] Other proteins in same PDB: d2v6ba1, d2v6bb1, d2v6bc1, d2v6bd1 automated match to d1llda2 |
PDB Entry: 2v6b (more details), 2.5 Å
SCOPe Domain Sequences for d2v6bd2:
Sequence, based on SEQRES records: (download)
>d2v6bd2 d.162.1.0 (D:165-325) automated matches {Deinococcus radiodurans [TaxId: 1299]} tvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvagmpvadfmqaqnlpw neqvrakidegtrnaaasiiegkratyygigaalariteavlrdrravltvsaptpeygv slslprvvgrqgvlstlhpkltgdeqqkleqsagvlrgf
>d2v6bd2 d.162.1.0 (D:165-325) automated matches {Deinococcus radiodurans [TaxId: 1299]} tvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvagmpvadfmqaqnlpw neqvrakidegtrtyygigaalariteavlrdrravltvsaptpeygvslslprvvgrqg vlstlhpkltgdeqqkleqsagvlrgf
Timeline for d2v6bd2: