SCOPe 2.03: Domain d2v6bc2: 2v6b C:165-326

Lineage for d2v6bc2 (2v6b C:165-326)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (21 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:1299] [225330] (1 PDB entry)

8. Domain d2v6bc2: 2v6b C:165-326 [206244]
   Other proteins in same PDB: d2v6ba1, d2v6bb1, d2v6bc1, d2v6bd1
   automated match to d1llda2

Details for d2v6bc2

PDB Entry: 2v6b, 2.5 Å

PDB Description: crystal structure of lactate dehydrogenase from deinococcus radiodurans (apo form)

PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2v6bc2:

Sequence, based on SEQRES records:

>d2v6bc2 d.162.1.0 (C:165-326) automated matches {Deinococcus radiodurans [TaxId: 1299]}
tvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvagmpvadfmqaqnlpw
neqvrakidegtrnaaasiiegkratyygigaalariteavlrdrravltvsaptpeygv
slslprvvgrqgvlstlhpkltgdeqqkleqsagvlrgfk

Sequence, based on observed residues (ATOM records):

>d2v6bc2 d.162.1.0 (C:165-326) automated matches {Deinococcus radiodurans [TaxId: 1299]}
tvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvagmpvadfmqaqnlpw
neqvrakidegtrntyygigaalariteavlrdrravltvsaptpeygvslslprvvgrq
gvlstlhpkltgdeqqkleqsagvlrgfk

Timeline for d2v6bc2:

• d2v6bc2 is new in SCOPe 2.03-stable
  
• d2v6bc2 appears in SCOPe 2.04
  
• d2v6bc2 appears in the current release, SCOPe 2.08