Lineage for d2v6bb2 (2v6b B:165-326)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (36 species)
    not a true protein
  7. 2557487Species Deinococcus radiodurans [TaxId:1299] [225330] (1 PDB entry)
  8. 2557489Domain d2v6bb2: 2v6b B:165-326 [206242]
    Other proteins in same PDB: d2v6ba1, d2v6bb1, d2v6bc1, d2v6bd1
    automated match to d1llda2

Details for d2v6bb2

PDB Entry: 2v6b (more details), 2.5 Å

PDB Description: crystal structure of lactate dehydrogenase from deinococcus radiodurans (apo form)
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2v6bb2:

Sequence, based on SEQRES records: (download)

>d2v6bb2 d.162.1.0 (B:165-326) automated matches {Deinococcus radiodurans [TaxId: 1299]}
tvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvagmpvadfmqaqnlpw
neqvrakidegtrnaaasiiegkratyygigaalariteavlrdrravltvsaptpeygv
slslprvvgrqgvlstlhpkltgdeqqkleqsagvlrgfk

Sequence, based on observed residues (ATOM records): (download)

>d2v6bb2 d.162.1.0 (B:165-326) automated matches {Deinococcus radiodurans [TaxId: 1299]}
tvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvagmpvadfmqaqnlpw
neqvrakidegtrtyygigaalariteavlrdrravltvsaptpeygvslslprvvgrqg
vlstlhpkltgdeqqkleqsagvlrgfk

SCOPe Domain Coordinates for d2v6bb2:

Click to download the PDB-style file with coordinates for d2v6bb2.
(The format of our PDB-style files is described here.)

Timeline for d2v6bb2: