Lineage for d1qrnd1 (1qrn D:1-117)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105447Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1105448Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries)
  8. 1105465Domain d1qrnd1: 1qrn D:1-117 [20624]
    Other proteins in same PDB: d1qrna1, d1qrna2, d1qrnb_, d1qrnd2, d1qrne2

Details for d1qrnd1

PDB Entry: 1qrn (more details), 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a
PDB Compounds: (D:) T-cell receptor, alpha chain

SCOPe Domain Sequences for d1qrnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrnd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

SCOPe Domain Coordinates for d1qrnd1:

Click to download the PDB-style file with coordinates for d1qrnd1.
(The format of our PDB-style files is described here.)

Timeline for d1qrnd1: