| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) ![]() |
| Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins) |
| Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species) |
| Species Clostridium perfringens [TaxId:1502] [140660] (7 PDB entries) Uniprot Q8XL08 496-624 |
| Domain d2v5cb3: 2v5c B:496-624 [206234] Other proteins in same PDB: d2v5ca1, d2v5ca2, d2v5cb1, d2v5cb2 automated match to d2cbia1 complexed with ca, cac, na |
PDB Entry: 2v5c (more details), 2.1 Å
SCOPe Domain Sequences for d2v5cb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v5cb3 a.246.1.1 (B:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli
Timeline for d2v5cb3: