| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
| Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
| Protein Hyaluronidase N-terminal domain [143619] (1 species) |
| Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries) Uniprot Q8XL08 41-178 |
| Domain d2v5cb1: 2v5c B:41-178 [206232] Other proteins in same PDB: d2v5ca2, d2v5ca3, d2v5cb2, d2v5cb3 automated match to d2cbia3 complexed with ca, cac, na |
PDB Entry: 2v5c (more details), 2.1 Å
SCOPe Domain Sequences for d2v5cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v5cb1 d.92.2.3 (B:41-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]}
vlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendpn
sttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtfk
qlvkesnipevnitdypt
Timeline for d2v5cb1: