Lineage for d1ao7d_ (1ao7 D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931485Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 931486Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries)
  8. 931507Domain d1ao7d_: 1ao7 D: [20623]
    Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b_, d1ao7e2
    C-domain not seen in the crystal structure, due to disorder
    complexed with emc

Details for d1ao7d_

PDB Entry: 1ao7 (more details), 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201
PDB Compounds: (D:) t cell receptor alpha

SCOPe Domain Sequences for d1ao7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ao7d_ b.1.1.1 (D:) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpdiqnp

SCOPe Domain Coordinates for d1ao7d_:

Click to download the PDB-style file with coordinates for d1ao7d_.
(The format of our PDB-style files is described here.)

Timeline for d1ao7d_: