SCOPe 2.07: Domain d1bd2d1: 1bd2 D:1-117

Lineage for d1bd2d1 (1bd2 D:1-117)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)
Domain d1bd2d1: 1bd2 D:1-117 [20622]
Other proteins in same PDB: d1bd2a1, d1bd2a2, d1bd2b_, d1bd2d2, d1bd2e2

Details for d1bd2d1

PDB Entry: 1bd2 (more details), 2.5 Å

PDB Description: complex between human t-cell receptor b7, viral peptide (tax) and mhc class i molecule hla-a 0201

PDB Compounds: (D:) t cell receptor alpha

SCOPe Domain Sequences for d1bd2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
qqvkqnspslsvqegrisilncdytnsmfdyflwykkypaegptflisissikdknadgr
ftvflnksakhlslhivpsqpgdsavyfcaamegaqklvfgqgtrltinpn

SCOPe Domain Coordinates for d1bd2d1:

Click to download the PDB-style file with coordinates for d1bd2d1.
(The format of our PDB-style files is described here.)

Timeline for d1bd2d1: