SCOP 1.55: Domain d1bd2d1: 1bd2 D:1-117

Lineage for d1bd2d1 (1bd2 D:1-117)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein T-cell antigen receptor [48933] (5 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (6 PDB entries)

8. Domain d1bd2d1: 1bd2 D:1-117 [20622]
   Other proteins in same PDB: d1bd2a1, d1bd2a2, d1bd2b1, d1bd2d2, d1bd2e2

Details for d1bd2d1

PDB Entry: 1bd2, 2.5 Å

PDB Description: complex between human t-cell receptor b7, viral peptide (tax) and mhc class i molecule hla-a 0201

SCOP Domain Sequences for d1bd2d1:

Sequence; same for both SEQRES and ATOM records:

>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
qqvkqnspslsvqegrisilncdytnsmfdyflwykkypaegptflisissikdknadgr
ftvflnksakhlslhivpsqpgdsavyfcaamegaqklvfgqgtrltinpn

Timeline for d1bd2d1:

• d1bd2d1 appears in SCOP 1.57
  
• d1bd2d1 appears in the current release, SCOPe 2.08