Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (10 PDB entries) |
Domain d1fytd1: 1fyt D:1-117 [20621] Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd2, d1fyte2 complexed with nag; mutant |
PDB Entry: 1fyt (more details), 2.6 Å
SCOP Domain Sequences for d1fytd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fytd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} qsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgin gfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipn
Timeline for d1fytd1: