Lineage for d1fytd1 (1fyt D:1-117)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 220318Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 220319Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (9 PDB entries)
  8. 220325Domain d1fytd1: 1fyt D:1-117 [20621]
    Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd2, d1fyte2
    complexed with nag; mutant

Details for d1fytd1

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1
PDB Compounds: (D:)

SCOP Domain Sequences for d1fytd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fytd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
qsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgin
gfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipn

SCOP Domain Coordinates for d1fytd1:

Click to download the PDB-style file with coordinates for d1fytd1.
(The format of our PDB-style files is described here.)

Timeline for d1fytd1: