Lineage for d1bwma1 (1bwm A:301-417)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein T-cell antigen receptor [48933] (5 species) 
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (10 PDB entries) 
Domain d1bwma1: 1bwm A:301-417 [20620]
Details for d1bwma1
PDB Entry: 1bwm (more details)
PDB Description: a single-chain t cell receptor
SCOP Domain Sequences for d1bwma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwma1 b.1.1.1 (A:301-417) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qqqvrqspqsltvwegettilncsyedstfdyfpwyrqfpgkspalliaislvsnkkedg
rftiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfgagtrlavspy
SCOP Domain Coordinates for d1bwma1:
Click to download the PDB-style file with coordinates for d1bwma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bwma1:
- d1bwma1 appears in SCOP 1.57
- d1bwma1 appears in the current release, SCOPe 2.07
View in 3D
