SCOPe 2.08: Domain d2v20a1: 2v20 A:1-268

Lineage for d2v20a1 (2v20 A:1-268)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (111 PDB entries)

8. Domain d2v20a1: 2v20 A:1-268 [206199]
   Other proteins in same PDB: d2v20a2
   automated match to d1jtda_
   complexed with so4, zn

Details for d2v20a1

PDB Entry: 2v20, 1.67 Å

PDB Description: structure of a tem-1 beta-lactamase insertant allosterically regulated by kanamycin and anions. complex with sulfate.

PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d2v20a1:

Sequence; same for both SEQRES and ATOM records:

>d2v20a1 e.3.1.1 (A:1-268) automated matches {Escherichia coli [TaxId: 562]}
petlvkvkdaedqlcrtshrpcrvgyieldlnsgkilesfrpeerfpmmstfkvllcgav
lsridagqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllt
tiggpkeltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgellt
lasrqqlidwmeadkvagpllrsalpagwfiadksgagrrgsrgiiaalgpdgkpsrivv
iyttgsrkktdernrqiaeigaslikhw

Timeline for d2v20a1:

• d2v20a1 first appeared in SCOPe 2.03, called d2v20a_
  
• d2v20a1 appears in SCOPe 2.07