SCOPe 2.04: Domain d2v1za_: 2v1z A:

Lineage for d2v1za_ (2v1z A:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (41 PDB entries)

8. Domain d2v1za_: 2v1z A: [206198]
   automated match to d1jtda_
   complexed with zn

Details for d2v1za_

PDB Entry: 2v1z, 1.6 Å

PDB Description: structure of a tem-1 beta-lactamase insertant allosterically regulated by kanamycin and anions.

PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d2v1za_:

Sequence; same for both SEQRES and ATOM records:

>d2v1za_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
petlvkvkdaedqlcrtshrpcrvgyieldlnsgkilesfrpeerfpmmstfkvllcgav
lsridagqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllt
tiggpkeltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgellt
lasrqqlidwmeadkvagpllrsalpagwfiadksgagrrgsrgiiaalgpdgkpsrivv
iyttgsrkktdernrqiaeigaslikhwgl

Timeline for d2v1za_:

• d2v1za_ first appeared in SCOPe 2.03
  
• d2v1za_ appears in SCOPe 2.05
  
• d2v1za_ appears in the current release, SCOPe 2.08, called d2v1za1