SCOP 1.71: Domain d1g6rc1: 1g6r C:1-117

Lineage for d1g6rc1 (1g6r C:1-117)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (16 PDB entries)
Domain d1g6rc1: 1g6r C:1-117 [20617]
Other proteins in same PDB: d1g6ra2, d1g6rb2, d1g6rc2, d1g6rd2, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2, d1g6rl_, d1g6rm_

Details for d1g6rc1

PDB Entry: 1g6r (more details), 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex

SCOP Domain Sequences for d1g6rc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6rc1 b.1.1.1 (C:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

SCOP Domain Coordinates for d1g6rc1:

Click to download the PDB-style file with coordinates for d1g6rc1.
(The format of our PDB-style files is described here.)

Timeline for d1g6rc1: