SCOPe 2.05: Domain d2uv3a_: 2uv3 A:

Lineage for d2uv3a_ (2uv3 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2uv3a_: 2uv3 A: [206164]
   automated match to d2i26o_
   complexed with mes, so4

Details for d2uv3a_

PDB Entry: 2uv3, 1.8 Å

PDB Description: structure of the signal-regulatory protein (sirp) alpha domain that binds cd47.

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type substrate 1

SCOPe Domain Sequences for d2uv3a_:

Sequence; same for both SEQRES and ATOM records:

>d2uv3a_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eelqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprvt
tvsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvrakpstrh

Timeline for d2uv3a_:

• d2uv3a_ first appeared in SCOPe 2.03
  
• d2uv3a_ appears in SCOPe 2.04
  
• d2uv3a_ is called d2uv3a1 in SCOPe 2.06
  
• d2uv3a_ appears in the current release, SCOPe 2.08, called d2uv3a1