Lineage for d2rkda1 (2rkd A:3-259)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920701Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2920702Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 2920712Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (42 PDB entries)
  8. 2920750Domain d2rkda1: 2rkd A:3-259 [206159]
    Other proteins in same PDB: d2rkda2
    automated match to d1khba2
    complexed with 3pp, mn, na

Details for d2rkda1

PDB Entry: 2rkd (more details), 1.9 Å

PDB Description: the structure of rat cytosolic pepck in complex with 3- phosphonopropionate
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d2rkda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rkda1 c.109.1.1 (A:3-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqe
egvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedf
ekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvle
algdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllg
kkcfalriasrlakeeg

SCOPe Domain Coordinates for d2rkda1:

Click to download the PDB-style file with coordinates for d2rkda1.
(The format of our PDB-style files is described here.)

Timeline for d2rkda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rkda2