SCOPe 2.07: Domain d2ckba1: 2ckb A:1-117

Lineage for d2ckba1 (2ckb A:1-117)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries)
Domain d2ckba1: 2ckb A:1-117 [20614]
Other proteins in same PDB: d2ckba2, d2ckbb2, d2ckbc2, d2ckbd2, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl_, d2ckbm_

Details for d2ckba1

PDB Description: structure of the 2c/kb/dev8 complex

PDB Compounds: (A:) alpha, beta t cell receptor

SCOPe Domain Sequences for d2ckba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckba1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

SCOPe Domain Coordinates for d2ckba1:

Click to download the PDB-style file with coordinates for d2ckba1.
(The format of our PDB-style files is described here.)

Timeline for d2ckba1: