SCOPe 2.04: Domain d2rgvb_: 2rgv B:

Lineage for d2rgvb_ (2rgv B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (52 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187193] (6 PDB entries)

8. Domain d2rgvb_: 2rgv B: [206106]
   automated match to d2o03a_
   complexed with zn

Details for d2rgvb_

PDB Entry: 2rgv, 2.05 Å

PDB Description: The crystal structure of PerR-Ox highlights 2-oxo-Histidine formation

PDB Compounds: (B:) Peroxide operon regulator

SCOPe Domain Sequences for d2rgvb_:

Sequence; same for both SEQRES and ATOM records:

>d2rgvb_ a.4.5.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
ahelkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynn
lrvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtg
fkvshhrleiygvcqecskkenh

Timeline for d2rgvb_:

• d2rgvb_ first appeared in SCOPe 2.03
  
• d2rgvb_ appears in SCOPe 2.05
  
• d2rgvb_ appears in the current release, SCOPe 2.08