SCOPe 2.04: Domain d2rgsb1: 2rgs B:237-339

Lineage for d2rgsb1 (2rgs B:237-339)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d2rgsb1: 2rgs B:237-339 [206103]
   automated match to d2ql1a1

Details for d2rgsb1

PDB Entry: 2rgs, 2.13 Å

PDB Description: fc-fragment of monoclonal antibody igg2b from mus musculus

PDB Compounds: (B:) Ig gamma-2B heavy chain

SCOPe Domain Sequences for d2rgsb1:

Sequence; same for both SEQRES and ATOM records:

>d2rgsb1 b.1.1.0 (B:237-339) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gpsvfifppnikdvlmisltpkvtcvvvdvseddpdvqiswfvnnvevhtaqtqthredy
nstirvvstlpiqhqdwmsgkefkckvnnkdlpspiertiski

Timeline for d2rgsb1:

• d2rgsb1 first appeared in SCOPe 2.03
  
• d2rgsb1 appears in SCOPe 2.05
  
• d2rgsb1 appears in the current release, SCOPe 2.08