Lineage for d1fo0a_ (1fo0 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 158716Protein T-cell antigen receptor [48933] (6 species)
  7. 158747Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (14 PDB entries)
  8. 158758Domain d1fo0a_: 1fo0 A: [20610]
    Other proteins in same PDB: d1fo0h1, d1fo0h2, d1fo0l1

Details for d1fo0a_

PDB Entry: 1fo0 (more details), 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1fo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
kvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatvg
hyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp

SCOP Domain Coordinates for d1fo0a_:

Click to download the PDB-style file with coordinates for d1fo0a_.
(The format of our PDB-style files is described here.)

Timeline for d1fo0a_: