SCOPe 2.03: Domain d1b88b_: 1b88 B:

Lineage for d1b88b_ (1b88 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)

8. Domain d1b88b_: 1b88 B: [20609]

Details for d1b88b_

PDB Entry: 1b88, 2.5 Å

PDB Description: v-alpha 2.6 mouse t cell receptor (tcr) domain

PDB Compounds: (B:) t cell receptor v-alpha domain

SCOPe Domain Sequences for d1b88b_:

Sequence; same for both SEQRES and ATOM records:

>d1b88b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
mqqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedg
rftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnp

Timeline for d1b88b_:

• d1b88b_ first appeared (with stable ids) in SCOP 1.55
  
• d1b88b_ appears in SCOPe 2.02
  
• d1b88b_ appears in SCOPe 2.04
  
• d1b88b_ appears in the current release, SCOPe 2.08