Lineage for d1b88b_ (1b88 B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653994Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 654042Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (17 PDB entries)
  8. 654053Domain d1b88b_: 1b88 B: [20609]

Details for d1b88b_

PDB Entry: 1b88 (more details), 2.5 Å

PDB Description: v-alpha 2.6 mouse t cell receptor (tcr) domain
PDB Compounds: (B:) t cell receptor v-alpha domain

SCOP Domain Sequences for d1b88b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b88b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
mqqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedg
rftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnp

SCOP Domain Coordinates for d1b88b_:

Click to download the PDB-style file with coordinates for d1b88b_.
(The format of our PDB-style files is described here.)

Timeline for d1b88b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b88a_