Lineage for d1b88b_ (1b88 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 548189Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 548226Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (16 PDB entries)
  8. 548237Domain d1b88b_: 1b88 B: [20609]

Details for d1b88b_

PDB Entry: 1b88 (more details), 2.5 Å

PDB Description: v-alpha 2.6 mouse t cell receptor (tcr) domain

SCOP Domain Sequences for d1b88b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b88b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
mqqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedg
rftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnp

SCOP Domain Coordinates for d1b88b_:

Click to download the PDB-style file with coordinates for d1b88b_.
(The format of our PDB-style files is described here.)

Timeline for d1b88b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b88a_