SCOPe 2.06: Domain d2rcvf1: 2rcv F:2-92

Lineage for d2rcvf1 (2rcv F:2-92)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (32 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225413] (1 PDB entry)

8. Domain d2rcvf1: 2rcv F:2-92 [206068]
   Other proteins in same PDB: d2rcva2, d2rcvb2, d2rcvc2, d2rcvd2, d2rcve2, d2rcvf2, d2rcvg2, d2rcvh2
   automated match to d1dt0a1
   complexed with mn

Details for d2rcvf1

PDB Entry: 2rcv, 1.6 Å

PDB Description: crystal structure of the bacillus subtilis superoxide dismutase

PDB Compounds: (F:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2rcvf1:

Sequence; same for both SEQRES and ATOM records:

>d2rcvf1 a.2.11.0 (F:2-92) automated matches {Bacillus subtilis [TaxId: 1423]}
ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvadl
dsvpenirtavrnnggghanhklfwtllspn

Timeline for d2rcvf1:

• d2rcvf1 first appeared in SCOPe 2.03
  
• d2rcvf1 appears in SCOPe 2.05
  
• d2rcvf1 appears in SCOPe 2.07
  
• d2rcvf1 appears in the current release, SCOPe 2.08