Class a: All alpha proteins [46456] (286 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (31 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [225413] (1 PDB entry) |
Domain d2rcvd1: 2rcv D:2-92 [206064] Other proteins in same PDB: d2rcva2, d2rcvb2, d2rcvc2, d2rcvd2, d2rcve2, d2rcvf2, d2rcvg2, d2rcvh2 automated match to d1dt0a1 complexed with mn |
PDB Entry: 2rcv (more details), 1.6 Å
SCOPe Domain Sequences for d2rcvd1:
Sequence, based on SEQRES records: (download)
>d2rcvd1 a.2.11.0 (D:2-92) automated matches {Bacillus subtilis [TaxId: 1423]} ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvadl dsvpenirtavrnnggghanhklfwtllspn
>d2rcvd1 a.2.11.0 (D:2-92) automated matches {Bacillus subtilis [TaxId: 1423]} ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegnanksveelvadldsv penirtavrnnggghanhklfwtllspn
Timeline for d2rcvd1: