Lineage for d2rcvb2 (2rcv B:93-201)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647686Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1647687Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1647961Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1647962Protein automated matches [226860] (25 species)
    not a true protein
  7. 1647979Species Bacillus subtilis [TaxId:1423] [225414] (1 PDB entry)
  8. 1647981Domain d2rcvb2: 2rcv B:93-201 [206061]
    Other proteins in same PDB: d2rcva1, d2rcvb1, d2rcvc1, d2rcvd1, d2rcve1, d2rcvf1, d2rcvg1, d2rcvh1
    automated match to d1dt0a2
    complexed with mn

Details for d2rcvb2

PDB Entry: 2rcv (more details), 1.6 Å

PDB Description: crystal structure of the bacillus subtilis superoxide dismutase
PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2rcvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcvb2 d.44.1.0 (B:93-201) automated matches {Bacillus subtilis [TaxId: 1423]}
gggeptgalaeeinsvfgsfdkfkeqfaaaaagrfgsgwawlvvnngkleitstpnqdsp
lsegktpilgldvwehayylnyqnrrpdyisafwnvvnwdevarlyser

SCOPe Domain Coordinates for d2rcvb2:

Click to download the PDB-style file with coordinates for d2rcvb2.
(The format of our PDB-style files is described here.)

Timeline for d2rcvb2: