Lineage for d2rcvb1 (2rcv B:2-92)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690385Species Bacillus subtilis [TaxId:1423] [225413] (1 PDB entry)
  8. 2690387Domain d2rcvb1: 2rcv B:2-92 [206060]
    Other proteins in same PDB: d2rcva2, d2rcvb2, d2rcvc2, d2rcvd2, d2rcve2, d2rcvf2, d2rcvg2, d2rcvh2
    automated match to d1dt0a1
    complexed with mn

Details for d2rcvb1

PDB Entry: 2rcv (more details), 1.6 Å

PDB Description: crystal structure of the bacillus subtilis superoxide dismutase
PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2rcvb1:

Sequence, based on SEQRES records: (download)

>d2rcvb1 a.2.11.0 (B:2-92) automated matches {Bacillus subtilis [TaxId: 1423]}
ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvadl
dsvpenirtavrnnggghanhklfwtllspn

Sequence, based on observed residues (ATOM records): (download)

>d2rcvb1 a.2.11.0 (B:2-92) automated matches {Bacillus subtilis [TaxId: 1423]}
ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavtalanksveelvadldsv
penirtavrnnggghanhklfwtllspn

SCOPe Domain Coordinates for d2rcvb1:

Click to download the PDB-style file with coordinates for d2rcvb1.
(The format of our PDB-style files is described here.)

Timeline for d2rcvb1: