SCOP 1.69: Domain d1ac6a_: 1ac6 A:

Lineage for d1ac6a_ (1ac6 A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (16 PDB entries)

8. Domain d1ac6a_: 1ac6 A: [20606]

Details for d1ac6a_

PDB Entry: 1ac6, 2.3 Å

PDB Description: crystal structure of a variable domain mutant of a t-cell receptor alpha chain

SCOP Domain Sequences for d1ac6a_:

Sequence; same for both SEQRES and ATOM records:

>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
dsvtqtegqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
featynkeatsfhlqkasvqesdsavyycalsggnnkltfgagtkltikp

Timeline for d1ac6a_:

• d1ac6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ac6a_ appears in SCOP 1.67
  
• d1ac6a_ appears in SCOP 1.71
  
• d1ac6a_ appears in the current release, SCOPe 2.08