Lineage for d1ac6a_ (1ac6 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein T-cell antigen receptor [48933] (5 species) 
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (10 PDB entries) 
Domain d1ac6a_: 1ac6 A: [20606]
Details for d1ac6a_
PDB Entry: 1ac6 (more details), 2.3 Å
PDB Description: crystal structure of a variable domain mutant of a t-cell receptor alpha chain
SCOP Domain Sequences for d1ac6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
dsvtqtegqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
featynkeatsfhlqkasvqesdsavyycalsggnnkltfgagtkltikp
SCOP Domain Coordinates for d1ac6a_:
Click to download the PDB-style file with coordinates for d1ac6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ac6a_:
- d1ac6a_ appears in SCOP 1.57
- d1ac6a_ appears in the current release, SCOPe 2.08
View in 3D
