Lineage for d2rc6d1 (2rc6 D:7-158)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793672Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2793673Protein automated matches [226870] (22 species)
    not a true protein
  7. 2793722Species Leptospira interrogans [TaxId:173] [225433] (2 PDB entries)
  8. 2793730Domain d2rc6d1: 2rc6 D:7-158 [206056]
    Other proteins in same PDB: d2rc6a2, d2rc6b2, d2rc6c2, d2rc6d2
    automated match to d1qufa1
    complexed with fad, nap, so4, zn

Details for d2rc6d1

PDB Entry: 2rc6 (more details), 2.7 Å

PDB Description: Refined structure of FNR from Leptospira interrogans bound to NADP+
PDB Compounds: (D:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d2rc6d1:

Sequence, based on SEQRES records: (download)

>d2rc6d1 b.43.4.0 (D:7-158) automated matches {Leptospira interrogans [TaxId: 173]}
ptrepqinlfkksnpykakvisnvlltpetgtgkrpkkegealvhrivlaidhsaypyvi
gqsggvippgedpekkakgladvgytvrlysiaspsysfgmkedniefiikrdniydeng
niqfkgvcsnymcdlkpgdevtmtgpsgkkfl

Sequence, based on observed residues (ATOM records): (download)

>d2rc6d1 b.43.4.0 (D:7-158) automated matches {Leptospira interrogans [TaxId: 173]}
ptrepqinlfkksnpykakvisnvlltpetgtgkrpkkegealvhrivlaidhsaypyvi
gqsggvippgedpekkakgladvgytvrlysiaspsysfgmkedniefiikrdniyngni
qfkgvcsnymcdlkpgdevtmtgpsgkkfl

SCOPe Domain Coordinates for d2rc6d1:

Click to download the PDB-style file with coordinates for d2rc6d1.
(The format of our PDB-style files is described here.)

Timeline for d2rc6d1: